PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G001000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 346aa    MW: 39025.8 Da    PI: 7.6115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G001000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Aqcoe2G001000.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding40.85e-1367112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++   E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Aqcoe2G001000.1.p  67 RGNFNSHEEGMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                        899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-23563IPR009057Homeodomain-like
PROSITE profilePS5129425.075965IPR017930Myb domain
SuperFamilySSF466892.46E-2911108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002493.5E-161461IPR001005SANT/Myb domain
CDDcd001671.07E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.2E-2364117IPR009057Homeodomain-like
PROSITE profilePS5129416.37966116IPR017930Myb domain
SMARTSM007172.4E-1166114IPR001005SANT/Myb domain
PfamPF002497.0E-1167112IPR001005SANT/Myb domain
CDDcd001675.44E-769112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF NSHEEGMIVH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKMKKFQ  120
SALAPTNSKT CHHQLLTNSY DGRMSLKSDM TMMNKTSGLL NLNQSSTTTT TYASSTENIS  180
RLLEGWMKTS PKDTNINSSS IIKPKGKHQR SKNDEDINHH PFLCNINQQP ANDNKVDQQE  240
SSSCDEHHHD DLISHEEFES LLSLENIMTS ICWEKSSCDS SSLTGRHGSQ TTTTEERRII  300
HSNSMSTSEF EKRSLENHPP LSLLEKWLLD EAAAGQVEVM SSEIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047044.11e-130PREDICTED: myb-related protein 306
SwissprotP813925e-89MYB06_ANTMA; Myb-related protein 306
TrEMBLB9I6601e-129B9I660_POPTR; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-128(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.14e-87myb domain protein 60